PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462849136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 401aa    MW: 43770.2 Da    PI: 10.0593
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462849136genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.3e-09110154246
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkv 46 
                rk+ +++keq   Lee F+++++++ ++++ LA++l+L  rqV v
  462849136 110 RKKLRLSKEQSAFLEESFKEHSTLNPKQKAALARQLNLRPRQVEV 154
                788899*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-1194154IPR009057Homeodomain-like
SuperFamilySSF466891.92E-898154IPR009057Homeodomain-like
PROSITE profilePS500718.989106154IPR001356Homeobox domain
SMARTSM003890.0089108164IPR001356Homeobox domain
PfamPF000464.4E-7110154IPR001356Homeobox domain
CDDcd000861.16E-7110154No hitNo description
PfamPF092293.3E-5151207IPR015310Activator of Hsp90 ATPase, N-terminal
CDDcd088921.72E-54266399No hitNo description
SuperFamilySSF559615.5E-18266400No hitNo description
PfamPF083276.8E-11281393IPR013538Activator of Hsp90 ATPase homologue 1-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006950Biological Processresponse to stress
GO:0005829Cellular Componentcytosol
GO:0001671Molecular FunctionATPase activator activity
GO:0003677Molecular FunctionDNA binding
GO:0051087Molecular Functionchaperone binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MELGLRGGGR GGRRRKGGAG AGAWAWGRSQ RGRAEAPARG FDVXXXXXXX XXXXXRAAAA  60
ALSSSPNDSG GSFPLDLGRR AARAEGAAQG GGGERSSSRA SDEDDGASAR KKLRLSKEQS  120
AFLEESFKEH STLNPKQKAA LARQLNLRPR QVEVPYLADE NADEDPDLRV TVRGEESPLA  180
RRAKDAFLTR GKPLVLEKIR EYVTAMAKGG PAKDEVDSKK TPTKAAAAPG VAGTVPATAA  240
KKEEAAQAPA MKEKKAKAKD KEGFKTIEMT EKFYCRAKDM YEILMDENRW KGFTQSNARI  300
SKEVGGEFSL FDGSITGVNE ELQEGKLIAQ KWRFGSWPDG LYSSVRLVFD EPESGVTIIK  360
LKQTDVPEED KYGNSTVVEN TERGWRELIF QRIRGVFGFG I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x53_A2e-1526740013138Activator of 90 kDa heat shock protein ATPase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9733461e-161EU973346.1 Zea mays clone 397151 activator of 90 kDa heat shock protein ATPase mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152033.11e-146uncharacterized protein LOC100285670
TrEMBLB6U7Y11e-146B6U7Y1_MAIZE; Activator of 90 kDa heat shock protein ATPase
STRINGGRMZM2G021816_P011e-145(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.17e-19homeobox from Arabidopsis thaliana